S/MARt DB - S/MARbinder

AC  SB000001
XX
DT  1.1.1999 00:00:00 (created); ili
DT  3.12.2004 13:10:00 (updated); ili2
XX
NA  SATB1
XX
SY  L2a-P1 
XX
OS  mouse, Mus musculus
OC  eukaryota; animalia; metazoa; chordata; vertebrata;
OC  tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae;
OC  murinae
XX
DE  G002305 
XX
HO  human SATB1
XX
SZ  764 AA; 85.9 kDa (cDNA), 103 kDa (SDS) [1]
XX
SQ  MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGGKMQGVPLKHS
SQ  GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SQ  SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVANMLQDVYHVVTLKIQLHSCPKLEDLP
SQ  PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
SQ  KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
SQ  PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
SQ  LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SQ  SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLLSTPPSRPPQVKTATLA
SQ  TERNGKPENNTMNINASIYDEIQQEMKRAKVSQAPFAKVAATKSQGWLCELLRWKEDPSP
SQ  ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQ
SQ  QQQQQQQPPPPPPQPQPQPQAGPRLPPRQPTVASSAESDEENRQKTRPRTKISVEALGIL
SQ  QSFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEY
SQ  KDEELLKDLEESVQDKNANTLFSVKLEEELSVEGSTDVNADLKD
SC  translated from EMBL #U05252
XX
FT  298 - 394: essential for association with transcription
FT             factor CDP  [6] 
FT  346 - 495: DNA-binding domain [1]
FT  355 - 363: important for DNA binding [2]
FT  362 - 448: CUT domain [10]
FT  484 - 571: CUT domain [10]
FT  593 - 607: Q-stretch [1]
FT  646 - 705: HOX domain [10]
XX
SF  phosphorylated [1]; binds as a monomer [1]; shares 67%
SF  overall sequence homology with SATB2 SB000110 [10]
XX
FF  has a cage-like 'network' distribution in thymocyte nuclei
FF  [9]; its 'network' resists salt extraction [9]; in
FF  thymocytes all in vivo SATB1 binding sites become
FF  chromatin-loop bases by anchoring to its network, thereby
FF  genes found within 4-60 kB of the binding sites become
FF  inducible on stimulation while others are activated or
FF  repressed [9]; shown to mediate the formation of a
FF  special histone code over a restricted region containing
FF  genes whose expression is SATB1-dependent [9]; assembles
FF  protein complexes containing factors found in CHRAC/ACF and
FF  NURD complexes [8]; ablation leads to dysregulated
FF  transcription of IL-7Ralpha, IL-2Ralpha, Mig, c-myc, APC,
FF  TSG101, T160, GABP, PD-1 RIP and TDAG51 genes in thymocytes
FF  [7]; necessary for T-cell development and function
FF  [7]; knockout mice showed growth retardation as early as
FF  3 days after birth, had much smaller thymus, spleen and
FF  lymph nodes than wild type mice and did not survive weaning
FF  [7]; may have a role in neurological function [7];
FF  interacts in vitro and in vivo with CDP  [6];
FF  may regulate CDP and may be regulated by CDP  via
FF  protein-protein interaction [6]
XX
IN  SB000079; CDP
IN  SB000099; HDAC1
IN  SB000100; ACF1
IN  SB000101; ISWI
XX
CP  predominantly in thymus [1]
XX
BS  SM0000044; MOUSE$IgHmu-5MAR [3]
MM  assessment of the dissociation constant;
MM  0.1 nM
SO  thymus, mouse; mouse
QA  6
BS  SM0000045; MOUSE$IgHmu-3MAR [3]
MM  assessment of the dissociation constant;
MM  1 nM
SO  thymus, mouse; mouse
QA  6
BS  SM0000046; AS$MAR [1]
MM  direct gel shift;
PR  (25)5
SO  rec(mouse-ret lys); mouse
QA  6
BS  SM0000046; AS$MAR [4]
MM  supershift (antibody binding);
PR  (25)5
SO  VL3; mouse
QA  6
BS  SM0000046; AS$MAR [4]
MM  gel shift competition;
PR  (25)5
SO  VL3; mouse
QA  6
BS  SM0000105; MOUSE$L2a [4]
MM  direct gel shift;
SO  VL3; mouse
QA  6
BS  SM0000105; MOUSE$L2a [4]
MM  supershift (antibody binding);
SO  VL3; mouse
QA  6
BS  SM0000105; MOUSE$L2a [4]
MM  replacement by distamycin A;
SO  VL3; mouse
QA  6
BS  SM0000338; MOUSE$TCRBL-MAR [5]
MM  supershift (antibody binding);
SO  thymocyte; mouse
QA  6
BS  SM0000338; MOUSE$TCRBL-MAR [5]
MM  gel shift competition;
SO  thymocyte; mouse
QA  6
BS  SM0000512; MOUSE$CMYC-5MAR [9]
MM  chromatin immunoprecipitation (ChIP);
SO  mouse thymus; mouse
QA  6
BS  SM0000513; MOUSE$SBS-418 [9]
MM  assessment of the dissociation constant;
MM  2 nM
SO  mouse; mouse
QA  6
BS  SM0000513; MOUSE$SBS-418 [9]
MM  chromatin immunoprecipitation (ChIP);
SO  mouse thymus; mouse
QA  6
BS  SM0000514; MOUSE$SBS-T4 [9]
MM  assessment of the dissociation constant;
MM  4-8 nM
SO  mouse; mouse
QA  6
BS  SM0000514; MOUSE$SBS-T4 [9]
MM  chromatin immunoprecipitation (ChIP);
SO  mouse thymus; mouse
QA  6
XX
DR  EMBL: U05252; MM05252; r 
DR  SwissProt: Q60611; SAB1_MOUSE
XX
RN  [1]
RX  MEDLINE; 94158857 PubMed; 8114718
RA  Nakagomi, K., Kohwi, Y., Dickinson, L. A., Kohwi-Shigematsu,
RA  T.
RT  A novel DNA-binding motif in the nuclear matrix attachment
RT  DNA-binding protein SATB1
RL  Mol. Biol. Cell 14:1852-1860 (1994)
RN  [2]
RX  MEDLINE; 96007453 PubMed; 7559473
RA  Wang, B., Dickinson, L. A., Koivunen, E., Ruoslahti, E.,
RA  Kohwi-Shigematsu, T.
RT  A novel matrix attachment region DNA binding motif
RT  identified using a random phage peptide library
RL  J. Biol. Chem. 270:23239-23242 (1995)
RN  [3]
RX  MEDLINE; 95098023 PubMed; 7799955
RA  Dickinson, L. A., Kohwi-Shigematsu, T.
RT  Nucleolin is a matrix attachment region DNA-binding protein
RT  that specifically recognizes a region with high
RT  base-unpairing potential
RL  Mol. Cell. Biol. 15:456-465 (1995)
RN  [4]
RX  MEDLINE; 97364778 PubMed; 9218488
RA  Banan, M., Rojas, I. C., Lee, W. H., King, H. L., Harriss,
RA  J.V., Kobayashi, R., Web, C. F., Gottlieb, P. D.
RT  Interaction of the nuclear matrix-associated region
RT  (MAR)-binding proteins, SATB1 and CDP/Cux, with a MAR
RT  element (L2a) in an upstream regulatory region of the mouse
RT  CD8a gene
RL  J. Biol. Chem. 272:18440-18452 (1997)
RN  [5]
RX  MEDLINE; 99009101 PubMed; 9792700
RA  Chattopadhyay, S., Whitehurst, C. E., Chen, J.
RT  A nuclear matrix attachment region upstream of the T cell
RT  receptor beta gene enhancer binds Cux/CDP and SATB1 and
RT  modulates enhancer-dependent reporter gene expression but
RT  not endogenous gene expression
RL  J. Biol. Chem. 273:29838-29846 (1998)
RN  [6]
RX  MEDLINE; 99303784 PubMed; 10373541
RA  Liu, J., Barnett, A., Neufeld, E. J., Dudley, J. P.
RT  Homeoproteins CDP and SATB1interact: potential for
RT  tissue-specific regulation
RL  Mol. Cell. Biol. 19:4918-4926 (1999)
RN  [7]
RX  MEDLINE; 20183675 PubMed; 10716941
RA  Alvarez, J. D., Yasui, D. H., Niida, H., Joh, T., Loh, D.
RA  Y., Kohwi-Shigematsu, T.
RT  The MAR-binding protein SATB1 orchestrates temporal and
RT  spatial expression of multiple genes during T-cell
RT  development
RL  Genes Dev. 14:521-535 (2000)
RN  [8]
RX  MEDLINE; 22262326 PubMed; 12374985
RA  Yasui, D., Miyano, M., Cai, S., Varga-Weisz, P.,
RA  Kohwi-Shigematsu, T.
RT  SATB1 targets chromatin remodelling to regulate genes over
RT  long distances
RL  Nature 419:641-645 (2002)
RN  [9]
RX  MEDLINE; 22608347 PubMed; 12692553
RA  Cai, S., Han, H.-J., Kohwi-Shigematsu, T.
RT  Tissue-specific nuclear architecture and gene expression
RT  regulated by SATB1
RL  Nat. Genet. 34:42-51 (2003)
RN  [10]
RX  MEDLINE;  PubMed; 14701874
RA  Dobreva, G., Dambacher, J., Grosschedl, R.
RT  SUMO modification of a novel MAR-binding protein, SATB2,
RT  modulates immunoglobulin mu gene expression
RL  Genes Dev. 17:3048-3061 (2003)
//