S/MARt DB - S/MARbinder

AC  SB000003
XX
DT  1.1.1999 00:00:00 (created); ili
DT  11.6.2001 16:19:00 (updated); ili
XX
NA  lamin B1
XX
OS  rat, Rattus norvegicus
OC  eukaryota; animalia; metazoa; chordata; vertebrata;
OC  tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae;
OC  murinae
XX
DE  G002419 
XX
SZ  587 AA;  66.6 kDa, 67 kDa (SDS) [2]
XX
SQ  MATATPVQQRAGSRASAPATPFSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSAL
SQ  QLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKFKAEHDQLLLN
SQ  YAKKESDLSGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLSAA
SQ  KKQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRRKHETRLVEVDSGRQIEYEY
SQ  KLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSARGGMMESRMRI
SQ  ESLSSQLSNLQKDSRACLERIQELEDMLAKERDNSRRMLSDKEREMAEIRDQMQQQLNDY
SQ  EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD
SQ  VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSV
SQ  SYKYTSRYVLKAGQTVTVWAANAGVTASPPTDLIWKNQNSWGTGEDVKVVLKNSQGEEVA
SQ  QRSTVFKTTIPEEEEEEEEEPIGVPLEEERFHQQGTPRASNKSCAIM
SC  SwissProt #P70615
XX
SF  central alpha-helical rod domain flanked by nonhelical ends
SF  [4]; may self-assemble into long polymers in which the
SF  rod domains are dimerized to coiled-coil molecules [4]
XX
FF  polymers of lamin A, B1 & C bind through single-stranded
FF  regions and minor groove contact [4]
XX
IN  SB000002; lamin A
IN  SB000004; lamin C
XX
CP  liver [2]; spermatocytes and spermatids [3]
XX
BS  SM0000001; MOUSE$kappa-MAR [4]
MM  nitrocellulose filter binding;
SO  rl; rat
QA  6
BS  SM0000037; DROME$H1H3 [4]
MM  nitrocellulose filter binding;
SO  rl; rat
QA  6
BS  SM0000037; DROME$H1H3 [2]
MM  southwestern blotting;
SO  rl; rat
QA  6
BS  SM0000037; DROME$H1H3 [4]
MM  replacement by distamycin A;
SO  rl; rat
QA  6
BS  SM0000037; DROME$H1H3 [4]
MM  replacement by chromomycin;
SO  rl; rat
QA  6
BS  SM0000050; RAT$GDH-5MAR [4]
MM  nitrocellulose filter binding;
SO  rl; rat
QA  6
XX
DR  EMBL: U72353; RNU72353; r 
DR  SwissProt: P70615; P70615
XX
RN  [1]
RX  MEDLINE; 91250423 PubMed; 2040622
RA  Hakes, D. J., Berezney, R.
RT  DNA binding properties of the nuclear matrix and individual
RT  nuclear matrix proteins. Evidence for salt-resistant DNA
RT  binding sites
RL  J. Biol. Chem. 266:11131-11140 (1991)
RN  [2]
RX  MEDLINE; 92405165 PubMed; 1525831
RA  Luderus, M. E. E., de Graaf, A., Mattia, E., den Blaauwen,
RA  J. L., Grande, M. A., de Jong, L., van Driel, R.
RT  Binding of matrix attachment regions to lamin B1
RL  Cell 70:949-959 (1992)
RN  [3]
RX  MEDLINE; 93280257 PubMed; 8505378
RA  Vester, B., Smith, A., Krohne, G., Benavente, R.
RT  Presence of a nuclear lamina in pachytene spermatocytes of
RT  the rat
RL  J. Cell Sci. 104:557-563 (1993)
RN  [4]
RX  MEDLINE; 94344140 PubMed; 8065361
RA  Luderus, M. E. E., den Blaauwen, J. L., de Smit, O. J. B.,
RA  Compton, D. A., van Driel, R.
RT  Binding of matrix attachment regions to lamin polymers
RT  involves single-stranded regions and the minor groove
RL  Mol. Cell. Biol. 14:6297-6305 (1994)
//