S/MARt DB - S/MARbinder

AC  SB000012
XX
DT  1.1.1999 00:00:00 (created); ili
DT  11.3.2004 17:30:00 (updated); ili2
XX
NA  SATB1
XX
SY  special AT-rich sequence binding protein 1 
XX
OS  human, Homo sapiens
OC  eukaryota; animalia; metazoa; chordata; vertebrata;
OC  tetrapoda; mammalia; eutheria; primates
XX
DE  G002308 
XX
HO  murine SATB1
XX
SZ  763 AA; 86.0 kDa (cDNA), ca. 90 kDa (SDS) [1], 96-97 kDa
SZ  (SDS) [5], 103 kDa (SDS) [2]
XX
SQ  MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS
SQ  GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SQ  SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
SQ  PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
SQ  KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
SQ  PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
SQ  LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SQ  SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA
SQ  TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
SQ  ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQ
SQ  QQQQQQQAPPPPQPQQQPQTGPRLPPRQPTVASPAESDEENRQKTRPRTKISVEALGILQ
SQ  SFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYK
SQ  EEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD
SC  SwissProt #Q01826
XX
FT  346 - 495: DNA-binding domain [2]
FT  370 - 445: similarity to Cut- and Clox-homeo-proteins of
FT             Drosophila and mammals [4] 
FT  493 - 568: similarity to Cut- and Clox-homeo-proteins of
FT             Drosophila and mammals [4] 
FT  593 - 607: Q-stretch [1]
FT  641 - 702: homeodomain-like domain [4]
XX
SF  phosphorylated [2]; binds as a monomer [2]; appears to
SF  be directed by its homeodomain-like domain toward a
SF  preferential recognition of the core unwinding element
SF  [4]
XX
FF  binds to minor groove with little contact to DNA bases
FF  [1]; does not bind to ssDNA [1]; contacts AT-rich
FF  sequences flanked by sequences in which 1 strand contains
FF  only C, A & T [1]; these AT-rich sequences must have
FF  unpairing properties [2]; a small quantity remains
FF  extractable after stabilization procedures [5]; caution:
FF  distribution changes according to the stabilizing treatment
FF  used during matrix preparation [5]; not affected by
FF  apotosis in hematopoietic cell line, but proteolyzed in
FF  apototic thymocytes [7]
XX
CP  predominantly in thymus [1]; minute amounts in brain
CP  [1]; very low in testis [1]; HL60 [2] [3];
CP  Jurkat [6]; K562 [5] [3]; U937, CEM, Namalwa, KG1,
CP  fetal liver, adult bone marrow [3]
CN  breast cancer cell line, SK-BR-3 [6]; HeLa [3]
XX
BS  SM0000044; MOUSE$IgHmu-5MAR [4]
MM  direct gel shift;
SO  rec(human-); human
QA  6
BS  SM0000044; MOUSE$IgHmu-5MAR [1]
MM  missing base interference;
SO  rec(human-); human
QA  6
BS  SM0000045; MOUSE$IgHmu-3MAR [4]
MM  direct gel shift;
SO  rec(human-); human
QA  6
BS  SM0000045; MOUSE$IgHmu-3MAR [1]
MM  missing base interference;
SO  rec(human-E.coli); human
QA  6
BS  SM0000045; MOUSE$IgHmu-3MAR [1]
MM  replacement by distamycin A;
SO  rec(human-ret lys); human
QA  6
BS  SM0000046; AS$MAR [4]
MM  direct gel shift;
SO  rec(human-); human
QA  6
BS  SM0000046; AS$MAR [1]
MM  methylation interference;
SO  rec(human-E.coli); human
QA  6
BS  SM0000046; AS$MAR [1]
MM  depurination interference;
SO  rec(human-E.coli); human
QA  6
BS  SM0000046; AS$MAR [1]
MM  missing base interference;
SO  rec(human-E.coli); human
QA  6
BS  SM0000084; HS$SBS-1 [6]
MM  assessment of the dissociation constant;
MM  29.2 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000085; HS$SBS-2 [6]
MM  assessment of the dissociation constant;
MM  6.4 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000086; HS$SBS-3 [6]
MM  direct gel shift;
SO  rec(human-E.coli); human
QA  6
BS  SM0000086; HS$SBS-3 [6]
MM  gel shift competition;
SO  rec(human-E.coli); human
QA  6
BS  SM0000086; HS$SBS-3 [6]
MM  assessment of the dissociation constant;
MM  1.1 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000087; HS$SBS-4 [6]
MM  assessment of the dissociation constant;
MM  13.2 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000088; HS$SBS-5 [6]
MM  assessment of the dissociation constant;
MM  12.4 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000089; HS$SBS-6 [6]
MM  assessment of the dissociation constant;
MM  6.7 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000090; HS$SBS-7 [6]
MM  assessment of the dissociation constant;
MM  4.0 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000091; HS$SBS-8 [6]
MM  assessment of the dissociation constant;
MM  8.4 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000092; HS$SBS-9 [6]
MM  assessment of the dissociation constant;
MM  13.5 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000093; HS$SBS-10 [6]
MM  assessment of the dissociation constant;
MM  5.9 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000094; HS$SBS-11 [6]
MM  assessment of the dissociation constant;
MM  3.8 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000095; HS$SBS-12 [6]
MM  assessment of the dissociation constant;
MM  2.8 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000096; HS$SBS-13 [6]
MM  assessment of the dissociation constant;
MM  11.6 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000097; HS$SBS-14 [6]
MM  direct gel shift;
SO  rec(human-E.coli); human
QA  6
BS  SM0000097; HS$SBS-14 [6]
MM  gel shift competition;
SO  rec(human-E.coli); human
QA  6
BS  SM0000097; HS$SBS-14 [6]
MM  assessment of the dissociation constant;
MM  2.0 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000098; HS$SBS-15 [6]
MM  assessment of the dissociation constant;
MM  10.0 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000099; HS$SBS-16 [6]
MM  assessment of the dissociation constant;
MM  12.1 nM
SO  rec(human-E.coli); human
QA  6
BS  SM0000100; POT$STLS1-MAR [1]
MM  direct gel shift;
SO  rec(human-ret lys); human
QA  6
BS  SM0000100; POT$STLS1-MAR [1]
MM  gel shift competition;
SO  rec(human-ret lys); human
QA  6
BS  SM0000115; Y$H4-ARS [1]
MM  direct gel shift;
PR  400 bp fragment containing H4 ARS
SO  rec(human-ret lys); human
QA  6
BS  SM0000115; Y$H4-ARS [1]
MM  gel shift competition;
PR  400 bp fragment containing H4 ARS
SO  rec(human-ret lys); human
QA  6
BS  SM0000178; HS$GLOBAG-3MAR [3]
MM  direct gel shift;
PR  nt 41399-41452, nt 41672-41707
SO  K562; human
QA  6
BS  SM0000178; HS$GLOBAG-3MAR [3]
MM  supershift (antibody binding);
PR  nt 41399-41452
SO  K562; human
QA  6
BS  SM0000178; HS$GLOBAG-3MAR [3]
MM  gel shift competition;
PR  nt 41399-41452
SO  K562; human
QA  6
BS  SM0000488; HS$CD8B1-3MAR5 [8]
MM  direct gel shift;
SO  rec(human-); human
QA  6
BS  SM0000488; HS$CD8B1-3MAR5 [8]
MM  assessment of the dissociation constant;
MM  0.04-0.15 nM
PR  subfragment
SO  rec(human-); human
QA  6
BS  SM0000490; HS$CD8B1-3MAR6 [8]
MM  direct gel shift;
SO  rec(human-); human
QA  6
BS  SM0000490; HS$CD8B1-3MAR6 [8]
MM  assessment of the dissociation constant;
MM  1.6-2 nM
PR  subfragment
SO  rec(human-); human
QA  6
XX
DR  EMBL: M97287; HSSATB1A; r 
DR  SwissProt: Q01826; SAT1_HUMAN
DR  PIR: A43314; A43314 
XX
RN  [1]
RX  MEDLINE; 92370684 PubMed; 1505028
RA  Dickinson, L. A., Joh, T., Kohwi, Y., Kohwi-Shigematsu, T.
RT  A tissue-specific MAR/SAR DNA-binding protein with unusual
RT  binding site recognition
RL  Cell 70:631-645 (1992)
RN  [2]
RX  MEDLINE; 94158857 PubMed; 8114718
RA  Nakagomi, K., Kohwi, Y., Dickinson, L. A., Kohwi-Shigematsu,
RA  T.
RT  A novel DNA-binding motif in the nuclear matrix attachment
RT  DNA-binding protein SATB1
RL  Mol. Biol. Cell 14:1852-1860 (1994)
RN  [3]
RX  MEDLINE; 94325576 PubMed; 8049444
RA  Cunningham, J. M., Purucker, M. E., Jane, S. M., Safer, B.,
RA  Vanin, E. F., Ney, P. A., Lowrey, C. H., Nienhuis, A. W.
RT  The regulatory element 3' to the gammaA-globin gene binds to
RT  the nuclear matrix and interacts with special A-T-rich
RT  binding protein (SATB1), an SAR/MAR-associating region DNA
RT  binding protein
RL  Blood 84:1298-1308 (1994)
RN  [4]
RX  MEDLINE; 97269059 PubMed; 9111059
RA  Dickinson, L. A., Dickinson, C. D., Kohwi-Shigematsu, T.
RT  An atypical homeodomain in SATB1 promotes specific
RT  recognition of the key structural element in a matrix
RT  attachment region
RL  J. Biol. Chem. 272:11463-11470 (1997)
RN  [5]
RX  MEDLINE; 97362021 PubMed; 9215557
RA  Neri, L. M., Fackelmayer, F. O., Zweyer, M.,
RA  Kohwi-Shigematsu, T., Martelli, A. M.
RT  Subnuclear localization of S/MAR-binding proteins is
RT  differently affected by in vitro stabilization with heat or
RT  Cu2+
RL  Chromosoma 106:81-93 (1997)
RN  [6]
RX  MEDLINE; 98215708 PubMed; 9548713
RA  deBelle, I., Cai, S., Kohwi-Shigematsu, T.
RT  The genomic sequences bound to special AT-rich
RT  sequence-binding protein 1(SATB1) in vivo in Jurkat T cells
RT  are tightly associated with the nuclear matrix at the bases
RT  of the chromatin loops
RL  J. Cell Biol. 141:335-348 (1998)
RN  [7]
RX  MEDLINE; 99148532 PubMed; 10025665
RA  Martelli, A. M., Bortul, R., Fackelmayer, F. O., Tazzari, P.
RA  L., Bareggi, R., Narducci, P., Zweyer, M.
RT  Biochemical and morphological characterization of the
RT  nuclear matrix from apoptotic HL-60 cells
RL  J. Cell. Biochem. 72:35-46 (1999)
RN  [8]
RX  MEDLINE; 21935500 PubMed; 11937547
RA  Kieffer, L. J., Greally, J. M., Landres, I., Nag, S.,
RA  Nakajima, Y., Kohwi-Shigematsu, T., Kavathas, P. B.
RT  Identification of a candidate regulatory region in the human
RT  CD8 gene complex by colocalization of DNase I
RT  hypersensitive sites and matrix attachment regions which
RT  bind SATB1 and GATA-3
RL  J. Immunol. 168:3915-3922 (2002)
//