S/MARt DB - S/MARbinder

AC  SB000017
XX
DT  1.1.1999 00:00:00 (created); ili
DT  28.5.2002 11:43:00 (updated); ili
XX
NA  hnRNP-U
XX
SY  SAF-A 
XX
OS  human, Homo sapiens
OC  eukaryota; animalia; metazoa; chordata; vertebrata;
OC  tetrapoda; mammalia; eutheria; primates
XX
DE  G002317 
XX
HO  chicken p120 [4]
XX
SZ  806 AA; 88.9 kDa (cDNA); 120 kDa (SDS) [1] [7]
IP  5.0 (2D-Gel) [1]
XX
SQ  MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSL
SQ  DLGGDSAGRSGAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGP
SQ  MEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAA
SQ  KEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGDGKTEQKGGDKKRGVKRPREDHGRGYFE
SQ  YIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFL
SQ  WAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSY
SQ  GYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGVAFKISKEVL
SQ  AGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKGPEEKKDCEV
SQ  VMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRA
SQ  PQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQK
SQ  KAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPP
SQ  EKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGLNMRGGNFRGGAPGNRGGYNRRGNMPQR
SQ  GGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQS
SQ  QGYNQWQQGQFWGQKPWSQHYHQGYY
SC  SwissProt #Q00839
XX
FT  1 - 45: spaced leucine motif, essential for DNA binding
FT          [5] [10] 
FT  11 - 41: SAF-box [10]
FT  100 - 100: in vitro and in vivo caspase-3 cleavage site
FT             [11] 
FT  158 - 247: Q-rich region [5]
FT  158 - 247: indispensible for DNA binding in Southwestern
FT             assays [5] [10] 
FT  663 - 728: necessary for binding to p300 [12]
FT  695 - 720: RNA binding motif (RGG-box) [2]
XX
SF  copurifies with PARP SB000062 and DNA-PK SB000055
SF  [9]; modified by DNA-PK [9]
XX
FF  induces the formation of DNA loops [1]; binds to
FF  poly(dA-dT) and to poly(dA) poly(dT) tracks [1]; approx.
FF  300 isolated SAF-boxes are necessary to bind one molecule of
FF  the topoisomerase-M2 MAR SM0000048 [10]; binding shows
FF  cooperative effects [10]; approximately 20% of the total
FF  cellular hnRNP-U are crosslinked to chromosomal DNA in vivo
FF  [3] [6]; localizes to chromosomes in two-thirds of the
FF  mitotic cells [10]; binds to ds, ssDNA & RNA [3];
FF  forms complexes of high order with nucleic acids [6996,
FF  7010]; deletion of N-terminal 45 AA result in a decrease of
FF  proliferation [10]; assumed to function in the
FF  organization of chromosomal DNA & packaging of hnRNA in
FF  ribonucleoprotein particles [3]; cleaved during apotosis,
FF  but not during necrosis, to a non-DNA-binding protein
FF  [5]; small amounts proteolysed in apototic hematopoietic
FF  cells [8]; caution: heat stabilization during matrix
FF  preparation lead to changes in distribution [7];
FF  concluded to contribute to S/MAR-binding activity of p114
FF  SB000030 [9]; interacts with p300 SB000083 [12];
FF  no binding to S/MARs in cells transfromed with adenovirus or
FF  SV40 [12]; no binding of p300-SAF-A to S/MAR elements of
FF  expressed gene [12]
XX
IN  SB000089; p300
XX
CP  HeLa, embryonic kidney cell line 293 [1]; K562 [7]
XX
BS  SM0000042; PH$TDNA [10]
MM  sedimentation assay;
SO  rec(human-E.coli); human
QA  6
BS  SM0000047; HS$TOPO-M1 [12]
MM  chromatin immunoprecipitation (ChIP);
SO  U2-OS; human
QA  6
BS  SM0000048; HS$TOPO-M2 [1]
MM  nitrocellulose filter binding;
SO  HeLa; human
QA  6
BS  SM0000048; HS$TOPO-M2 [1]
MM  southwestern blotting;
SO  HeLa; human
QA  6
BS  SM0000048; HS$TOPO-M2 [10]
MM  replacement by distamycin A;
SO  rec(human-E.coli); human
QA  6
BS  SM0000048; HS$TOPO-M2 [10]
MM  sedimentation assay;
SO  rec(human-E.coli); human
QA  6
BS  SM0000048; HS$TOPO-M2 [12]
MM  chromatin immunoprecipitation (ChIP);
SO  U2-OS; human
QA  6
BS  SM0000082; HS$kappa-MAR [12]
MM  chromatin immunoprecipitation (ChIP);
SO  U2-OS; human
QA  6
BS  SM0000114; HS$CMYC-3MAR [12]
MM  chromatin immunoprecipitation (ChIP);
SO  U2-OS; human
QA  6
BS  SM0000137; HS$GLOBB-3MAR1 [12]
MM  chromatin immunoprecipitation (ChIP);
SO  U2-OS; human
QA  6
XX
DR  EMBL: X65488; HSHNRNPU; r 
DR  SwissProt: Q00839; ROU_HUMAN
DR  PIR: S22765; S22765 
XX
RN  [1]
RX  MEDLINE; 92371451 PubMed; 1324173
RA  Romig, H., Fackelmayer, F. O., Renz, A., Ramsperger, U.,
RA  Richter, A.
RT  Characterization of SAF-A, a novel nuclear DNA binding
RT  protein from HeLa cells with high affinity for nuclear
RT  matrix/saffold attachment DNA elements
RL  EMBO J. 11:3431-3440 (1992)
RN  [2]
RX  MEDLINE; 92331618 PubMed; 1628625
RA  Kiledjian, M., Dreyfuss, G.
RT  Primary structure and binding activity of the hnRNP U
RT  protein: binding RNA through RGG box
RL  EMBO J. 11:2655-2664 (1992)
RN  [3]
RX  MEDLINE; 94229072 PubMed; 8174554
RA  Fackelmayer, F. O., Dahm, K., Renz, A., Ramsperger, U.,
RA  Richter, A.
RT  Nucleic-acid-binding properties of hnRNP-U/SAF-A a
RT  nuclear-matrix protein which binds DNA and RNA in vivo and
RT  in vitro
RL  Eur. J. Biochem. 221:749-757 (1994)
RN  [4]
RX  MEDLINE; 94218245 PubMed; 8165135
RA  von Kries, J. P., Buck, F., Straetling, W. H.
RT  Chicken MAR binding protein p120 is identical to human
RT  herterogeneous nuclear ribonucleoprotein (hnRNP) U
RL  Nucleic Acids Res. 22:1215-1220 (1994)
RN  [5]
RX  MEDLINE; 98070313 PubMed; 9405365
RA  Goehring, F., Schwab, B. L., Nicotera, P., Leist, M.,
RA  Fackelmayer, F. O.
RT  The novel SAR-binding domain of scaffold attachment factor A
RT  (SAF-A) is a target in apoptotic nuclear breakdown
RL  EMBO J. 16:7361-7371 (1997)
RN  [6]
RX  MEDLINE; 97349272 PubMed; 9204873
RA  Goehring, F., Fackelmayer, F. O.
RT  The scaffold/matrix attachment region binding protein
RT  hnRNP-U (SAF-A) is directly bound to chromosomal DNA in
RT  vivo: a chemical cross-linking study
RL  Biochemistry 36:8276-8283 (1997)
RN  [7]
RX  MEDLINE; 97362021 PubMed; 9215557
RA  Neri, L. M., Fackelmayer, F. O., Zweyer, M.,
RA  Kohwi-Shigematsu, T., Martelli, A. M.
RT  Subnuclear localization of S/MAR-binding proteins is
RT  differently affected by in vitro stabilization with heat or
RT  Cu2+
RL  Chromosoma 106:81-93 (1997)
RN  [8]
RX  MEDLINE; 99148532 PubMed; 10025665
RA  Martelli, A. M., Bortul, R., Fackelmayer, F. O., Tazzari, P.
RA  L., Bareggi, R., Narducci, P., Zweyer, M.
RT  Biochemical and morphological characterization of the
RT  nuclear matrix from apoptotic HL-60 cells
RL  J. Cell. Biochem. 72:35-46 (1999)
RN  [9]
RX  MEDLINE; 20271503 PubMed; 10813395
RA  Galande, S., Kohwi-Shigematsu, T.
RT  Caught in the act: binding of Ku and PARP to MARs reveals
RT  novel aspects of their functional interaction
RL  Crit. Rev. Eukaryot. Gene Expr. 10:63-72 (2000)
RN  [10]
RX  MEDLINE; 20459251 PubMed; 11003645
RA  Kipp, M., Goehring, F., Ostendorp, T., van Drunen, C. M.,
RA  van Driel, R., Przybylski, M., Fackelmayer, F. O.
RT  SAF-Box, a conserved protein domain that specifically
RT  recognizes scaffold attachment region DNA
RL  Mol. Cell. Biol. 20:7480-7489 (2000)
RN  [11]
RX  MEDLINE; 20138248 PubMed; 10671544
RA  Kipp, M., Schwab, B. L., Przybylski, M., Nicotera, P.,
RA  Fackelmayer, F. O.
RT  Apoptotic cleavage of scaffold attachment factor A (SAF-A)
RT  by caspase-3 occurs at a noncanonical cleavage site
RL  J. Biol. Chem. 275:5031-5036 (2000)
RN  [12]
RX  MEDLINE; 21907223 PubMed; 11909954
RA  Martens, J. H. A., Verlaan, M., Kalkhoven, E., Dorsman, J.
RA  C., Zantema, A.
RT  Scaffold/matrix attachment region elements interact with a
RT  p300-scaffold attachment factor A complex and are bound by
RT  acetylated nucleosomes
RL  Mol. Cell. Biol. 22:2598-2606 (2002)
//