S/MARt DB - S/MARbinder

AC  SB000019
XX
DT  1.1.1999 00:00:00 (created); ili
DT  3.9.2002 15:15:00 (updated); ili
XX
NA  MFP1
XX
SY  MAR binding filament-like protein 1 
XX
OS  tomato, Lycopersicon esculentum
OC  eukaryota; viridiplantae; embryobionta; magnoliophyta;
OC  magnoliopsida; asteridae; solanes; solanaceae
XX
DE  G002319 
XX
SZ  697 AA; 79.5 kDa (cDNA)
XX
SQ  MATSCFPPFSASSSSLCSSQFTPLLSCPRNTQICRKKRPVMASMHSENQKESNVCNRRSI
SQ  LFVGFSVLPLLNLRARALEGLSTDSQAQPQKEETEQTIQGSAGNPFVSLLNGLGVVGSGV
SQ  LGSLYALARNEKAVSDATIESMKNKLKDKEDAFVSMKKQFESELLSEREDRNKLIRREGE
SQ  ERQALVNQLKSAKTTVISLGQELQNEKKLAEDLKFEIKGLQNDLMNTKEDKKKLQEELKE
SQ  KLDLIQVLEEKITLLTTEIKDKEVSLRSNTSKLAEKESEVNSLSDMYQQSQDQLMNLTSE
SQ  IKELKDEIQKRERELELKCVSEDNLNVQLNSLLLERDESKKELHAIQKEYSEFKSNSDEK
SQ  VASDATLGEQEKRLHQLEEQLGTALSEASKNEVLIADLTREKENLRRMVDAELDNVNKLK
SQ  QEIEVTQESLENSRSEVSDITVQLEQLRDLSSKLEREVSKLQMELEETRASLQRNIDETK
SQ  HSSELLAAELTTTKELLKKTNEEMHTMSDELVAVSENRDSLQTELVNVYKKREHTRNELK
SQ  QEKTIVRTLEEELKFLESQITREKELRKSLEDELEKATESLDEINRNVLALAEELELATS
SQ  RNSSLEDEREVHRQSVSEQKQISQEAQENLEDAHSLVMKLGKERESLEKRAKKLEDEMAA
SQ  AKGEILRLRSQINSVKAPVEDEEKVVAGEKEKVNVQQ
SC  translated from EMBL #Y07861
XX
FT  1 - 125: important for tageting to the speckles [3]
FT  57 - 75: predicted transmembrane domain [1];
FT  110 - 128: predicted transmembrane domain [1];
FT  127 - 697: long filament-like alpha-helical domain [1];
FT  440 - 697: DNA binding domain [1]
XX
SF  N terminus is necessary for proper localization [3]
XX
FF  cloned within a screen for the fruit-specific DNA binding
FF  protein F-box binding factor (FBF) [1]; in vitro
FF  substrate for casein kinase II [1]; associated with
FF  speckle-like structures at the nuclear periphery [3]
XX
IN  SB000063; MAF1
XX
CP  ubiquitous [1]
XX
BS  SM0000031; GG$LYS-5MAR [1]
MM  southwestern blotting;
SO  rec(tomato-E.coli); tomato
QA  6
BS  SM0000037; DROME$H1H3 [1]
MM  southwestern blotting;
SO  rec(tomato-E.coli); tomato
QA  6
BS  SM0000101; TO$rbcS1-5MAR [2]
MM  southwestern blotting;
SO  rec(tomato-E.coli); tomato
QA  6
BS  SM0000102; TO$rbcS2-5MAR [2]
MM  southwestern blotting;
SO  rec(tomato-E.coli); tomato
QA  6
BS  SM0000103; TO$rbcS3A-5MAR [2]
MM  southwestern blotting;
SO  rec(tomato-E.coli); tomato
QA  6
XX
DR  EMBL: Y07861; LEMFP1; r 
DR  SwissProt: P93203; P93203
XX
RN  [1]
RX  MEDLINE; 97112038 PubMed; 8953774
RA  Meier, I., Phelan, T., Gruissem, W., Spiker, S., Schneider,
RA  D.
RT  MFP1, a novel plant filament-like protein with affinity for
RT  matrix attachment region DNA
RL  Plant Cell 8:2105-2115 (1996)
RN  [2]
RX  MEDLINE; 97465656 PubMed; 9326376
RA  Meier, I., Groening, B., Michalowski, S., Spiker, S.
RT  The tomato RBCS3A promoter requires integration into the
RT  chromatin for correct organ-specific regulation
RL  FEBS Lett. 415:91-95 (1997)
RN  [3]
RX  MEDLINE; 99296444 PubMed; 10368182
RA  Gindullis, F., Meier, I.
RT  Matrix attachment region binding protein MFP1 is localized
RT  in discrete domains at the nuclear envelope
RL  Plant Cell 11:1117-1128 (1999)
//