S/MARt DB - S/MARbinder

AC  SB000022
XX
DT  1.1.1999 00:00:00 (created); ili
DT  8.3.2001 18:59:00 (updated); ili
XX
NA  topoisomerase II
XX
OS  fruit fly, Drosophila melanogaster
OC  eukaryota; animalia; metazoa; arthropoda; insecta; diptera;
OC  drosophiloidea; drosophilidae
XX
DE  G002320 
XX
SZ  1447 AA; 164.4 kDa (cDNA)
XX
SQ  MENGNKALSIEQMYQKKSQLEHILLRPDSYIGSVEFTKELMWVYDNSQNRMVQKEISFVP
SQ  GLYKIFDEILVNAADNKQRDKSMNTIKIDIDPERNMVSVWNNGQGIPVTMHKEQKMYVPT
SQ  MIFGHLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSTSFTVETATREYKKSFKQTWGNNMG
SQ  KASDVQIKDFNGTDYTRITFSPDLAKFKMDRLDEDIVALMSRRAYDVAASSKGVSVFLNG
SQ  NKLGVRNFKDYIDLHIKNTDDDSGPPIKIVHEVANERWEVACCPSDRGFQQVSFVNSIAT
SQ  YKGGRHVDHVVDNLIKQLLEVLKKKNKGGINIKPFQVRNHLWVFVNCLIENPTFDSQTKE
SQ  NMTLQQKGFGSKCTLSEKFINNMSKSGIVESVLAWAKFKAQNDIAKTGGRKSSKIKGIPK
SQ  LEDANEAGGKNSIKCTLILTEGDSAKSLAVSGLGVIGRDLYGVFPLRGKLLNVREANFKQ
SQ  LSENAEINNLCKIIGLQYKKKYLTEDDLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHTN
SQ  WPELLRLPFLEEFITPIVKATKKNEELSFYSLPEFEEWKNDTANHHTYNIKYYKGLGTST
SQ  SKEAKEYFQDMDRHRILFKYDGSVDDESIVMAFSKKHIESRKVWLTNHMDEVKRRKELGL
SQ  PERYLYTKGTKSITYADFINLELVLFSNADNERSIPSLVDGLKPGQRKVMFTCFKRNDKR
SQ  EVKVAQLSGSVAEMSAYHHGEVSLQMTIVNLAQNFVGANNINLLEPRGQFGTRLSGGKDC
SQ  ASARYIFTIMSPLTRLIYHPLDDPLLDYQVDDGQKIEPLWYLPIIPMVLVNGAEGIGTGW
SQ  STKISNYNPREIMKNLRKMINGQEPSVMHPWYKNFLGRMEYVSDGRYIQTGNIQILSGNR
SQ  LEISELPVGVWTQNYKENVLEPLSNGTEKVKGIISEYREYHTDTTVRFVISFAPGEFERI
SQ  HAEEGGFYRVFKLTTTLSTNQMHAFDQNNCLRRFPTAIDILKEYYKLRREYYARRRDFLV
SQ  GQLTAQADRLSDQARFILEKCEKKLVVENKQRKAMCDELLKRGYRPDPVKEWQRRIKMED
SQ  AEQADEEDEEEEEAAPSVSSKAKKEKEVDPEKAFKKLTDVKKFDYLLGMSMWMLTEEKKN
SQ  ELLKQRDTKLSELESLRKKTPEMLWLDDLDALESKLNEVEEKERAEEQGINLKTAKALKG
SQ  QKSASAKGRKVKSMGGGAGAGDVFPDPDGEPVEFKITEEIIKKMAAAAKVAQAAKEPKKP
SQ  KEPKEPKVKKEPKGKQIKAEPDASGDEVDEFDAMVEGGSKTSPKAKKAVVKKEPGEKKPR
SQ  QKKENGGGLKQSKIDFSKAKAKKSDDDVEEVTPRAERPGRRQASKKIDYSSLFSDEEEDG
SQ  GNVGSDDDGNASDDDSPKRPAKRGREDESSGGAKKKAPPKKRRAVIESDDDDIEIDEDDD
SQ  DDSDFNC
SC  SwissProt #P15348
XX
FF  supposed to act as a fastener for the chromatin loop [2];
FF  aggregates S/MAR containing DNA fragments via a cooperative
FF  interaction [2]; shows different cleavage patterns in
FF  vitro and in vivo [2]
XX
BS  SM0000001; MOUSE$kappa-MAR [1]
MM  gel retardation;
SO  Drosophila; Drosophila melanogaster
QA  6
BS  SM0000001; MOUSE$kappa-MAR [1]
MM  topoisomerase II cleavage assay;
SO  Drosophila; Drosophila melanogaster
QA  6
BS  SM0000037; DROME$H1H3 [1]
MM  gel retardation;
SO  Drosophila; Drosophila melanogaster
QA  6
BS  SM0000118; DROME$SatIII [2]
MM  topoisomerase II cleavage assay;
SO  Kc; Drosophila
QA  6
XX
DR  EMBL: X61209; DMTOPII; g 
DR  SwissProt: P15348; TOP2_DROME
DR  PIR: S02160; S02160 
XX
RN  [1]
RX  MEDLINE; 89315824 PubMed; 2546156
RA  Sperry, A. O., Blasquez, V. C., Garrard, W. T.
RT  Dysfunction of chromosomal llop attachment sites:
RT  Illegitimate recombination linked to matrix association
RT  regions and topoisomerase II
RL  Proc. Natl. Acad. Sci. USA 86:5497-5501 (1989)
RN  [2]
RX  MEDLINE; 92164660 PubMed; 1311255
RA  Kaes, E., Laemmli, U. K.
RT  In vivo topoisomerase II cleavage of the Drosophila histone
RT  and satellite III repeats: DNA sequence and structural
RT  characteristics
RL  EMBO J. 11:705-716 (1992)
//