S/MARt DB - S/MARbinder

AC  SB000027
XX
DT  1.1.1999 00:00:00 (created); ili
DT  29.1.2002 12:01:00 (updated); ili
XX
NA  Lam-Dm0
XX
OS  fruit fly, Drosophila melanogaster
OC  eukaryota; animalia; metazoa; arthropoda; insecta; diptera;
OC  drosophiloidea; drosophilidae
XX
DE  G002323 
XX
SZ  622 AA; 71.2 kDa (cDNA)
XX
SQ  MSSKSRRAGTATPQPGNTSTPRPPSAGPQPPPPSTHSQTASSPLSPTRHSRVAEKVELQN
SQ  LNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTAR
SQ  DRARAEIDIKRLWERNEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKK
SQ  LNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINE
SQ  SRRIKQTEYSEIDGRLSSEYDAKLKQSLQDVRAQYEEQMQINRDEIQSLIEDKIQRLQEA
SQ  AARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQE
SQ  IDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTAT
SQ  VQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDP
SQ  EGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASH
SQ  EPPSSLVMKSQKWVSADNTRTILLNSEGEAVANLDRIKRIVSQHTSSSRLSRRRSVTAVD
SQ  GNEQLYHQQGDPQQSNEKCAIM
SC  SwissProt #P08928
XX
FT  64 - 64: A to H mutation abolishes multimerization
XX
SF  S/MAR binding site is within the alpha-helical rod domain
SF  [3]; processed forms are Dm1 and Dm2 [2]; type B
SF  lamin [4]
XX
FF  multimerization required for S/MAR binding [3]; reduced
FF  expression strongly affects viability, fertilty and
FF  locomotion [4]; required for normal nuclear envelop
FF  assembly and nuclear pore distribution [4];
FF  isoprenylated during interphase [5]; phosphorylation
FF  blocks head-to-tail polymerization in vitro [5]; closely
FF  associated with both DNA and RNA during interphase [5];
FF  suggested to interact with A-T-rich as well G-C-rich DNA
FF  [5]
XX
CP  expressed throughout development [1]; transcript levels
CP  decrease after the larval stages [1]
CN  mature sperm [1]
XX
BS  SM0000110; DROME$anon-MAR [2]
MM  sedimentation assay;
SO  rec(Drosophila-E.coli); fruit fly, Drosophila melanogaster
QA  6
BS  SM0000123; DROME$ftz-5MAR [3]
MM  sedimentation assay;
SO  rec(Drosophila-E.coli); fruit fly, Drosophila melanogaster
QA  6
XX
DR  EMBL: X07278; DMLAMDM0; r 
DR  EMBL: X16275; DMLAMIN; g 
DR  SwissProt: P08928; LAM0_DROME
XX
RN  [1]
RX  MEDLINE; 96019253 PubMed; 7593280
RA  Riemer, D., Stuurman, N., Berrios, M., Hunter, C., Fisher,
RA  P. A., Weber, K.
RT  Expression of Drosophila lamin C is developmentally
RT  regulated: analogies with vertebrate A-type lamins
RL  J. Cell Sci. 108:3189-3198 (1995)
RN  [2]
RX  MEDLINE; 96257215 PubMed; 8666268
RA  Baricheva, E. A., Berrios, M., Bogachev, S. S., Borisevich,
RA  I. V., Lapik, E. R., Sharakhov, I. V., Stuurman, N., Fisher,
RA  P. A.
RT  DNA from the Drosophila melanogaster beta-heterochromatin
RT  binds specifically to nuclear lamins in vitro and to the
RT  nuclear envelope in situ
RL  Gene 171:171-176 (1996)
RN  [3]
RX  MEDLINE; 96181689 PubMed; 8603728
RA  Zhao, K., Harel, A., Stuurman, N., Guedalia, D., Gruenbaum,
RA  Y.
RT  Binding of matrix attachment regions to nuclear lamin is
RT  mediated by the rod domain and depends on the lamin
RT  polymerization state
RL  FEBS Lett. 380:161-164 (1996)
RN  [4]
RX  MEDLINE; 97311071 PubMed; 9166402
RA  Lenz-Boehme, B., Wismar, J., Fuchs, S., Reifegerste, R.,
RA  Buchner, E., Betz, H., Schmitt, B.
RT  Insertional mutation of the Drosophila nuclear lamin Dm0
RT  gene results in defective nuclear envelopes, clustering of
RT  nuclear pore complexes, and accumulation of annulate
RT  lamellae
RL  J. Cell Biol. 137:1001-1016 (1997)
RN  [5]
RX  MEDLINE; 98055835 PubMed; 9394018
RA  Rzepecki, R., Bogachev, S. S., Kokoza, E., Stuurman, N.,
RA  Fisher, P. A.
RT  In vivo association of lamins with nucleic acids in
RT  Drosophila melanogaster
RL  J. Cell Sci. 111:121-129 (1998)
//