S/MARt DB - S/MARbinder

AC  SB000035
XX
DT  8.2.1999 16:01:19 (created); ili
DT  8.3.2001 19:39:00 (updated); ili
XX
NA  topoisomerase II
XX
SY  TOP2 
XX
OS  fission yeast, Schizosaccharomyces pombe
OC  Eukaryota; Fungi; Ascomycota; Archiascomycetes;
OC  Schizosaccharomycetales; Schizosaccharomycetaceae;
OC  Schizosaccharomyces.
XX
DE  G002324 
XX
SZ  1431 AA; 162.1 kDa (cDNA)
XX
SQ  MTASEQIPLVTNNGNGNSNVSTQYQRLTPREHVLRRPDTYIGSIEPTTSEMWVFDSEKNK
SQ  LDYKAVTYVPGLYKIFDEIIVNAADNKVRDPNMNTLKVTLDPEANVISIYNNGKGIPIEI
SQ  HDKEKIYIPELIFGNLLTSSNYDDNQKKVTGGRNGYGAKLCNIFSTEFVVETADKERMKK
SQ  YKQTWYDNMSRKSEPVITSLKKPDEYTKITFKPDLAKFGMDKIDDDMVSIIKRRIYDMAG
SQ  TVRETKVYLNNERISISGFKKYVEMYLASDTKPDEEPPRVIYEHVNDRWDVAFAVSDGQF
SQ  KQVSFVNNISTIRGGTHVNYVANKIVDAIDEVVKKENKKAPVKAFQIKNYVQVFVNCQIE
SQ  NPSFDSQTKETLTTKVSAFGSQCTLSDKFLKAIKKSSVVEEVLKFATAKADQQLSKGDGG
SQ  LRSRITGLTKLEDANKAGTKESHKCVLILTEGDSAKSLAVSGLSVVGRDYYGVFPLRGKL
SQ  LNVREASHSQILNNKEIQAIKKIMGFTHKKTYTDVKGLRYGHLMIMTDQDHDGSHIKGLI
SQ  INYLESSYPSLLQIPGFLIQFITPIIKCTRGNQVQAFYTLPEYEYWKEANNNGRGWKIKY
SQ  YKGLGTSDHDDMKSYFSDLDRHMKYFHAMQEKDAELIEMAFAKKKADVRKEWLRTYRPGI
SQ  YMDYTQPQIPIDDFINRELIQFSMADNIRSIPSVVDGLKPGQRKVVYYCFKRNLVHETKV
SQ  SRLAGYVASETAYHHGEVSMEQTIVNLAQNFVGSNNINLLMPNGQFGTRSEGGKNASASR
SQ  YLNTALSPLARVLFNSNDDQLLNYQNDEGQWIEPEYYVPILPMVLVNGAEGIGTGWSTFI
SQ  PNYNPKDITANLRHMLNGEPLEIMTPWYRGFRGSITKVAPDRYKISGIINQIGENKVEIT
SQ  ELPIRFWTQDMKEYLEAGLVGTEKIRKFIVDYESHHGEGIVHFNVTLTEAGMKEALNESL
SQ  EVKFKLSRTQATSNMIAFDASGRIKKYDSVEDILTEFYEVRLRTYQRRKEHMVNELEKRF
SQ  DRFSNQARFIHMIIEGELVVSKKKKKDLIVELKEKKFQPISKPKKGHLVDLEVENALAEE
SQ  EQSGDVSQDEDSDAYNYLLSMPLWSLTYERYVELLKKKDEVMAELDALIKKTPKELWLHD
SQ  LDAFEHAWNKVMDDIQREMLEEEQSSRDFVNRTKKKPRGKSTGTRKPRAIAGSSSSTAVK
SQ  KEASSESKPSTTNRKQQTLLEFAASKEPEKSSDINIVKTEDNSHGLSVEENRISKSPGLD
SQ  SSDSGKSRKRSQSVDSEDAGSKKPVKKIAASASGRGRKTNKPVATTIFSSDDEDDLLPSS
SQ  LKPSTITSTKASAKNKGKKASSVKKQSPEDDDDDFIIPGSSSTPKASSTNAEPPEDSDSP
SQ  IRKRPTRRAAATVKTPIYVDPSFDSMDEPSMQDDSFIVDNDEDVDDYDESD
SC  SwissProt #P08096
XX
SF  C-terminal region is supposed to be the chromatin binding
SF  domain [2]
XX
FF  relaxes supercoiled DNA [1]; resolves catenated and
FF  knotted DNAs [1]; necessary for chromosome separation in
FF  mitosis [1]; required for the final steps of chromosome
FF  condensation [3]; binds preferentially and
FF  cooperatively to S/MAR-containing DNA [3];
FF  sequence-dependent cleavage is altered by VM26, i.e. minor
FF  cleavage sites become major sites in the presence of the
FF  drug [3]; interaction with S/MAR elements involve
FF  (dA)(dT)-tracts [3]
XX
BS  SM0000122; DROME$hsp70-MAR1 [3]
MM  sedimentation assay;
SO  rec(S.pombe-S.pombe); Schizosaccharomyces pombe
QA  6
BS  SM0000123; DROME$ftz-5MAR [3]
MM  sedimentation assay;
SO  rec(S.pombe-S.pombe); Schizosaccharomyces pombe
QA  6
BS  SM0000125; DROME$adh-5MAR2 [3]
MM  sedimentation assay;
SO  rec(S.pombe-S.pombe); Schizosaccharomyces pombe
QA  6
BS  SM0000126; DROME$adh-5MAR1 [3]
MM  sedimentation assay;
SO  rec(S.pombe-S.pombe); Schizosaccharomyces pombe
QA  6
XX
DR  EMBL: X04326; SPTOP2; g 
DR  SwissProt: P08096; TOP2_SCHPO
XX
RN  [1]
RA  Uemura, T., Yanagida, M.
RT  Mitotic spindle pulls but fails to seperate chromosomes in
RT  type II DNA topoisomerase mutants: uncoordinated mitosis
RL  EMBO J. 5:1003-1010 (1986)
RN  [2]
RX  MEDLINE; 87053875 PubMed; 3023070
RA  Uemura, T., Morikawa, K., Yanagida, M.
RT  The nucleotide sequence of the fission yeast DNA
RT  topoisomerase II gene: structural and fuctional
RT  relationships to other topoisomerases
RL  EMBO J. 5:2355-2361 (1986)
RN  [3]
RX  MEDLINE; 90076119 PubMed; 2556260
RA  Adachi, Y., Kaes, E., Laemmli, U. K.
RT  Preferential, cooperative binding of DNA topoisomerase II to
RT  scaffold-associated regions
RL  EMBO J. 8:3997-4006 (1989)
//