S/MARt DB - S/MARbinder

AC  SB000036
XX
DT  1.3.1999 12:26:04 (created); ili
DT  1.2.2002 14:03:00 (updated); ili
XX
NA  NuMA
XX
SY  nuclear-mitotic apparatus protein centrophilin 
XX
OS  human, Homo sapiens
OC  eukaryota; animalia; metazoa; chordata; vertebrata;
OC  tetrapoda; mammalia; eutheria; primates
XX
DE  G002325 
XX
HO  African Green Monkey, pig [1]
XX
SZ  2115 AA;  238.3 kDa (cDNA), 240 kDa (SDS) [4]
IP  5.5 [1]
XX
SQ  MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSER
SQ  LDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFE
SQ  YKIQAELAVILKFVLDHEDGLNLNEDLENFLQKAPVPSTCSSTFPEELSPPSHQAKREIR
SQ  FLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAEN
SQ  RKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQ
SQ  DLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSKATQEWLEKQA
SQ  QLEKELSAALQDKKCLEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQ
SQ  EAATLAANNTQLQARVEMLETERGQQEAKLLAERGHFEEEKQQLSSLITDLQSSISNLSQ
SQ  AKEELEQASQAHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQ
SQ  QQEQASQGLRHQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERD
SQ  AALKQLEALEKEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVE
SQ  TARQEQHEAQAQVAELELQLRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEE
SQ  EKRRAADALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQA
SQ  ETEVLRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKE
SQ  ECEKARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLAD
SQ  DLSTLQEKMAATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQGRQF
SQ  CSTQAALQAMEREAEQMGNELERLRAALMESQGQQQEERGQQEREVARLTQERGRAQADL
SQ  ALEKAARAELEMRLQNALNEQRVEFATLQEALAHALTEKEGKDQELAKLRGLEAAQIKEL
SQ  EELRQTVKQLKEQLAKKEKEHASGSGAQSEAAGRTEPTGPKLEALRAEVSKLEQQCQKQQ
SQ  EQADSLERSLEAERASRAERDSALETLQGQLEEKAQELGHSQSALASAQRELAAFRTKVQ
SQ  DHSKAEDEWKAQVARGRQEAERKNSLISSLEEEVSILNRQVLEKEGESKELKRLVMAESE
SQ  KSQKLEERLRLLQAETASNSARAAERSSALREEVQSLREEAEKQRVASENLRQELTSQAE
SQ  RAEELGQELKAWQEKFFQKEQALSTLQLEHTSTQALVSELLPAKHLCQQLQAEQAAAEKR
SQ  HREELEQSKQAAGGLRAELLRAQRELGELIPLRQKVAEQERTAQQLRAEKASYAEQLSML
SQ  KKAHGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRADAETRLAEVQREAQS
SQ  TARELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEQLEVFQREQTKQVEELSKKLAD
SQ  SDQASKVQQQKLKAVQAQGGESQQEAQRLQAQLNELQAQLSQKEQAAEHYKLQMEKAKTH
SQ  YDAKKQQNQELQEQLRSLEQLQKENKELRAEAERLGHELQQAGLKTKEAEQTCRHLTAQV
SQ  RSLEAQVAHADQQLRDLGKFQVATDALKSREPQAKPQLDLSIDSLDLSCEEGTPLSITSK
SQ  LPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFQDS
SQ  GRKTRSARRRTTQIINITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARL
SQ  GSPDYGNSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRI
SQ  AELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGDPQETLRRASMQPIQIAEGTG
SQ  ITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTK
SQ  QADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA
SQ  AAIGATPRAKGKAKH
SC  translated from EMBL #Z11583
XX
FT  216 - 1700: central alpha-helical domain [1]
FT  592 - 596: potential phosphorylation site for PKC [1]
FT  1830 - 1908: basic C-terminal region 1 [1]
FT  1935 - 1950: required for microtubule binding [5]
FT  1966 - 1969: potential phosphorylation site for
FT               cAMP-dependent protein kinase [1] 
FT  1987 - 2005: nuclear localization signal [5]
FT  2012 - 2016: potential phosphorylation site for PKC [1]
FT  2015 - 2018: potential phosphorylation site for cdc2 kinase
FT               [1] 
FT  2029 - 2116: basic C-terminal region 2 [1]
FT  2044 - 2047: potential phosphorylation site for
FT               cAMP-dependent protein kinase [1] 
FT  2055 - 2058: potential phosphorylation site for cdc2 kinase
FT               [1] 
FT  2087 - 2090: potential phosphorylation site for cdc2 kinase
FT               [1] 
FT  2106 - 2109: potential phosphorylation site for cdc2 kinase
FT               [1] 
XX
SF  globular head, tail domain and central alpha-helical rod
SF  [2] [4]; central domain contains heptad periodicity of
SF  hydrophobic residues [1]; may dimerize through its
SF  central domain by adapting a coiled-coil structure [1];
SF  phosphoprotein [1]; 19 potential sites for Ca
SF  2+/calmodulin kinases dispersed through rod and C-terminus
SF  [1]; may bind DNA via the basic regins in the C-terminal
SF  region [1]; isoforms of lower apparent molecular masses
SF  generated by alternative splicing [3]
XX
FF  component of the nuclear matrix [4]; supposed to create
FF  a filimentous network [4]; shown to build up a
FF  three-dimensional lattice with hexagonal arrays in
FF  interphase nuclei when overexpressed [5]; found not
FF  affected by stabilization procedures during matrix
FF  preparation [4]; localizes to the polar region of the
FF  spindle apparatus in mitotic cells [1]; may be important
FF  in the early steps of nuclear reassembly [1];
FF  autoimmune disease patients sometimes have antibodies
FF  against it [1]; colocalize with snRNPs in interphase
FF  [3]; proteolysed in cells of hematopoietic cell line
FF  induced for apotosis [6]; N- and C-terminus show
FF  different subnuclear distribution in apototic hematopoietic
FF  cells [6]
XX
CP  K562 cells [4], HeLa [1]
XX
BS  SM0000037; DROME$H1H3 [2]
MM  sedimentation assay;
SO  rec(human-baculovirus-Sf9); human
QA  6
XX
DR  EMBL: Z11583; HSNUMAMR; r 
DR  PIR: S23647; S23647 
XX
RN  [1]
RX  MEDLINE; 92176231 PubMed; 1541630
RA  Yang, C. H., Lambie, E. J., Snyder, M.
RT  NuMA: an unsusually long coiled-coil related protein in the
RT  mammalian nucleus
RL  J. Cell Biol. 116:1303-1317 (1992)
RN  [2]
RX  MEDLINE; 94344140 PubMed; 8065361
RA  Luderus, M. E. E., den Blaauwen, J. L., de Smit, O. J. B.,
RA  Compton, D. A., van Driel, R.
RT  Binding of matrix attachment regions to lamin polymers
RT  involves single-stranded regions and the minor groove
RL  Mol. Cell. Biol. 14:6297-6305 (1994)
RN  [3]
RX  MEDLINE; 94151358 PubMed; 8108437
RA  Zeng, C., He, D., Berget, S. M., Brinkley, B.R.
RT  Nuclear-mitotic apparatus protein: a structural protein
RT  interface between nucleoskeleton and RNA splicing
RL  Proc. Natl. Acad. Sci. USA 91:1505-1509 (1994)
RN  [4]
RX  MEDLINE; 97362021 PubMed; 9215557
RA  Neri, L. M., Fackelmayer, F. O., Zweyer, M.,
RA  Kohwi-Shigematsu, T., Martelli, A. M.
RT  Subnuclear localization of S/MAR-binding proteins is
RT  differently affected by in vitro stabilization with heat or
RT  Cu2+
RL  Chromosoma 106:81-93 (1997)
RN  [5]
RX  MEDLINE; 98417584 PubMed; 9743603
RA  Gueth-Hallonet, C., Wang, J., Harborth, J., Weber, K.,
RA  Osborn, M.
RT  Induction of a regular nuclear lattice by overexpression of
RT  NuMA
RL  Exp. Cell Res. 243:434-452 (1998)
RN  [6]
RX  MEDLINE; 99148532 PubMed; 10025665
RA  Martelli, A. M., Bortul, R., Fackelmayer, F. O., Tazzari, P.
RA  L., Bareggi, R., Narducci, P., Zweyer, M.
RT  Biochemical and morphological characterization of the
RT  nuclear matrix from apoptotic HL-60 cells
RL  J. Cell. Biochem. 72:35-46 (1999)
//