S/MARt DB - S/MARbinder

AC  SB000044
XX
DT  16.4.1999 15:14:14 (created); ili
DT  17.12.2001 16:25:00 (updated); ili
XX
NA  Bright
XX
SY  B cell regulator of immunoglobulin heavy-chain transcription 
XX
OS  mouse, Mus musculus
OC  eukaryota; animalia; metazoa; chordata; vertebrata;
OC  tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae;
OC  murinae
XX
DE  G002328 
XX
SZ  601 AA;  64 kDa (cDNA), 75 kDa (SDS) [1]
XX
SQ  MKLQAVMETLIQRQQRARQELEARQAPPPPPPEPTGVRARTTMTDEDREPENARMHRTQM
SQ  AALAAMRAAAAGLGHPSSPGGSEDGPPISGDEDTAREGTLSSPALHGSVLEGAGHAEGDR
SQ  HLMDVGSDDDDTKSKWEEQELEELGEEEEEEEEEDDFEEEEEEEEGLGPPESASLGTAGL
SQ  FTRKAPPAQAFRGDGGPRMLSGPERLGPGPAHPSHMASQMPPPDHGDWTFEEQFKQLYEL
SQ  DADPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWR
SQ  EITKGLNLPTSITSAAFTLRTQYMKYLYPYECERRGLSSPNELQAAIDSNRREGRRQSFG
SQ  GSLFAYSPSGAHSMLPSPKLPVTPLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPV
SQ  SLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESTEPPEKKMALVADEQQRLMQ
SQ  RAVQQSFLAMTAQLPMNIRINSQASESRQDSAVSLTSANGSNSISMSVEMNGIVYTGVLF
SQ  AQPPPPTAPSAPGKGGVSSIGTNTTTGSRTGASGSTVSGGQVGLPGVSTPTMSSTSNNSL
SQ  P
SC  translated from EMBL #U60335
XX
FT  128 - 165: acidic region (28/38) [1] [4]
FT  226 - 360: "ARID" domain, necessary for DNA binding [12159,
FT             17413] 
FT  401 - 404: nuclear localization signal [1]
FT  427 - 453: A-rich stretch (16/27) with Q repeats [1]
FT  455 - 561: "REKLES" self association domain [4]
FT  486 - 601: S/T-rich region (36/116) [1]
FT  490 - 561: necessary for DNA binding [1]
XX
SF  numerous phosphorylation sites [1]; binds as a tetramer
SF  [1]; possible alternative spliced forms [2]
XX
FF  interacts with minor groove [1]; binding requires a
FF  minimum length of 13 bp [1]; binding site is composed of
FF  a core hexamer (RATWAA) and 2 closely spaced AT dimers
FF  [1]; binding sites need to be in the context of an
FF  active enhancer for trans-activation [1]; eliminated
FF  from its binding sites by NF-muNR/Cux/CDP [3]; distorts
FF  DNA to an angle of 80-90 [5]; overexpression induces
FF  increased DNase I hypersensitivity of the IgH mu enhancer
FF  [5]; localizes within the nuclear matrix [4]
XX
IN  SB000044; Bright
IN  SB000069; Sp100
IN  SB000075; LYSp100/p140
XX
CP  present in small pre-B cells, low levels in large pre-B
CP  cells (by RT-PCR) [2]; mature B cells, adult testis
CP  [1]; fetal thymus, liver and brain [2];
CP  LPS-stimulated spleen [2]; adult bone marrow [2]
CN  immature B cells [2]; T cell lines [1] [2]; adult
CN  liver [2]
XX
BS  SM0000044; MOUSE$IgHmu-5MAR [1]
MM  direct gel shift;
SO  rec(mouse-ret lys); mouse
QA  6
BS  SM0000044; MOUSE$IgHmu-5MAR [1]
MM  gel shift competition;
SO  rec(mouse-ret lys); mouse
QA  6
BS  SM0000045; MOUSE$IgHmu-3MAR [1]
MM  direct gel shift;
SO  rec(mouse-ret lys); mouse
QA  6
BS  SM0000045; MOUSE$IgHmu-3MAR [1]
MM  gel shift competition;
SO  rec(mouse-ret lys); mouse
QA  6
BS  SM0000136; MOUSE$IgH-5MAR [1]
MM  direct gel shift;
PR  Tx125 fragment
SO  rec(S.pombe-ret lys); fission yeast, Schizosaccharomyces pombe
QA  6
BS  SM0000136; MOUSE$IgH-5MAR [1]
MM  supershift (antibody binding);
PR  Tx125 fragment
SO  rec(S.pombe-ret lys); fission yeast, Schizosaccharomyces pombe
QA  6
BS  SM0000136; MOUSE$IgH-5MAR [1]
MM  gel shift competition;
PR  Tx125 fragment
SO  rec(S.pombe-ret lys); fission yeast, Schizosaccharomyces pombe
QA  6
BS  SM0000136; MOUSE$IgH-5MAR [1]
MM  replacement by distamycin A;
PR  Tx125 fragment
SO  rec(S.pombe-ret lys); fission yeast, Schizosaccharomyces pombe
QA  6
XX
DR  EMBL: U60335; MMU60335; r 
XX
RN  [1]
RX  MEDLINE; 96127903 PubMed; 8543152
RA  Herrscher, R. F., Kaplan, M. H., Lelsz, D. L., Das, C.,
RA  Scheuermann, R. H., Tucker, P. W.
RT  The immunoglobulin heavy-chain matrix-assocating regions are
RT  bound by Bright: a B cell-specific trans-activator that
RT  describes a new DNA-binding protein family
RL  Genes Dev. 9:3067-3082 (1995)
RN  [2]
RX  MEDLINE; 98250102 PubMed; 9590220
RA  Webb, C. F., Smith, E. A., Medina, K. L., Buchanan, K. L.,
RA  Smithson, G., Dou, S.
RT  Expression of Bright at two distinct stages of B lymphocyte
RT  development
RL  J. Immunol. 160:4747-4754 (1998)
RN  [3]
RX  MEDLINE; 99077966 PubMed; 9858552
RA  Wang, Z., Goldstein, A., Zong, R. T., Lin, D., Neufeld, E.
RA  J., Scheuermann, R. H., Tucker, P. W.
RT  Cux/CDP homeoprotein is a component of NF-muNR and represses
RT  the immunoglobulin heavy chain intronic enhancer by
RT  antagonizing the bright  transcription activator
RL  Mol. Cell. Biol. 19:284-295 (1999)
RN  [4]
RX  MEDLINE; 20380945 PubMed; 10921892
RA  Zong, R.-T., Das, C., Tucker, P. W.
RT  Regulation of matrix attachment region-dependent,
RT  lymphocyte-restricted transcription through differential
RT  localization within promyelocytic leukemia nuclear bodies
RL  EMBO J. 19:4123-4133 (2000)
RN  [5]
RX  MEDLINE; 21293104 PubMed; 11294836
RA  Kaplan, M. H., Zong, R.-T., Herrscher, R. F., Scheuermann,
RA  R. H., Tucker, P. W.
RT  Transcriptional activation by a matrix associating
RT  region-binding protein
RL  J. Biol. Chem. 276:21325-21330 (2001)
//