S/MARt DB - S/MARbinder

AC  SB000067
XX
DT  18.1.2001 11:02:18 (created); ili
DT  9.3.2001 11:31:00 (updated); ili
XX
NA  SMAR1
XX
OS  mouse, Mus musculus
OC  eukaryota; animalia; metazoa; chordata; vertebrata;
OC  tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae;
OC  murinae
XX
DE  G002327 
XX
SZ  548 AA; 59.7 kDa (cDNA), 60 kDa (SDS) [1]
XX
SQ  MMSEQDLADVVQIAVEDLSPDHPVVLENHVVTDDDEPALKRQRLEINCQDPSIKSFLYSI
SQ  NQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVR
SQ  CVVPQTTVILINDRQNAIVAKMEDPLINRAPDSLENIISNAVPGRRQNTIVVKVPGQDDS
SQ  HNEDGESGSEASDSVSNCGQPGSQNIGSNVTLITLNSEEDYPNGTWLGDENNPEMRVRCA
SQ  IIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCH
SQ  LFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPSSSSYSASETMMGT
SQ  PPPTSELQQSQPQALHYALANAQQVQIHQIGEDGQVQVIPQGHLHIAQVPQGEQVQITQD
SQ  SEGNLQIHHVGQDGQSWGLCQNPIPVSGDSVAQANPSQLWPLGGDTLDLPAGNEMIQVLQ
SQ  GAQLIAVASSDPAATGVDGSPLQGSDIQVQYVQLAPVSDHTAAAQTAEALQPTLQPDMQL
SQ  EHGAIQIQ
SC  translated from EMBL #AF235503
XX
FT  122 - 160: missed in splice variant [1]
FT  399 - 401: missed in splice variant [1]
XX
SF  shares some similarity with CDP SB000025 and the
SF  DNA-binding domains of SATB1  and Bright
SF  SB000044 [1]
XX
CP  highest mRNA levels in thymus [1]; double positive and
CP  negative thymocytes, activated T cells, thymomas, B cell
CP  lymphoma [1]; spleen, bone marrow, kidney, liver,
CP  intestine, lung, heart, muscle, brain [1]
XX
BS  SM0000001; MOUSE$kappa-MAR [1]
MM  gel shift competition;
SO  rec(mouse-E.coli); mouse
QA  6
BS  SM0000338; MOUSE$TCRBL-MAR [1]
MM  direct gel shift;
SO  rec(mouse-E.coli); mouse
QA  6
BS  SM0000338; MOUSE$TCRBL-MAR [1]
MM  gel shift competition;
SO  rec(mouse-E.coli); mouse
QA  6
BS  SM0000338; MOUSE$TCRBL-MAR [1]
MM  southwestern blotting;
SO  rec(mouse-); mouse
QA  6
XX
RN  [1]
RX  MEDLINE; 20408892 PubMed; 10950932
RA  Chattopadhyay, S., Kaul, R., Charest, A., Housman, D., Chen,
RA  J.
RT  SMAR1, a novel, alternatively spliced gene product, binds
RT  the scaffold/matrix-associated region at the T cell receptor
RT  beta locus
RL  Genomics 68:93-96 (2000)
//