S/MARt DB - S/MARbinder

AC  SB000098
XX
DT  27.7.2004 16:41:00 (created); ili2
DT  27.7.2004 17:19:00 (updated); ili2
XX
NA  CENP-A
XX
SY  centromere protein A 
XX
OS  human, Homo sapiens
OC  eukaryota; animalia; metazoa; chordata; vertebrata;
OC  tetrapoda; mammalia; eutheria; primates
XX
DE  G009707 
XX
SZ  140 AA; 16 kDa (cDNA)
XX
SQ  MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHL
SQ  LIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVT
SQ  LFPKDVQLARRIRGLEEGLG
SC  SwissProt #P49450
XX
BS  SM0000518; HS$invdup20-MAR4 [1]
MM  CIA;
SO  rec(human-); human
BS  SM0000520; HS$invdup20-MAR6 [1]
MM  CIA;
SO  rec(human-); human
BS  SM0000521; HS$invdup20-MAR7 [1]
MM  CIA;
SO  rec(human-); human
BS  SM0000522; HS$invdup20-MAR8 [1]
MM  CIA;
SO  rec(human-); human
XX
DR  EMBL: U14518; HS14518; 
DR  EMBL: U82609; HSU82609; 
DR  SwissProt: P49450; CENA_HUMAN
DR  PIR: I38855; I38855 
XX
RN  [1]
RX  MEDLINE; 21154920 PubMed; 11230169
RA  Lo, A. W. I., Magliano, D. J., Sibson, M. C., Kalitsis, P.,
RA  Craig, J. M., Choo, K. H. A.
RT  A novel chromatin immunoprecipitation and array (CIA)
RT  analysis identifies a 460-kb CENP-A-binding neocentromere
RT  DNA
RL  Genome Res. 11:448-457 (2001)
//