S/MARt DB - S/MARbinder

AC  SB000109
XX
DT  13.10.2004 14:03:00 (created); ili2
DT  13.10.2004 14:38:00 (updated); ili2
XX
NA  PEP
XX
SY  protein on ecdysone puffs 
XX
OS  fruit fly, Drosophila melanogaster
OC  eukaryota; animalia; metazoa; arthropoda; insecta; diptera;
OC  drosophiloidea; drosophilidae
XX
DE  G010115 
XX
SZ  716 AA; 78 kDa (cDNA), 110 kDa (SDS) [1]
IP  5.5 (cal)
XX
SQ  MVSVKVNGNPQNRLVNNAKVNGNMAFRGNQNRNRNFGGGNNNYGGPMGANRMGGMNMSPW
SQ  ESQNPGGGQFGNNMRQGGGQMNAQAINLANNLLNNLFRNQNPPSLLDLPRGGGGMGNRNQ
SQ  RGGPMVSRGGGAGNRLNNRRGQGGGFQNRGATGSGPKPPPKQGGGGIRKQNAFDRAKKLL
SQ  AKNANQNKKKEPTPGEKKIESPTKESPYASVPNDMFYCHLCKKHMWDANSFENHIKGRTH
SQ  LMMREGIEESYRLKANMIRQEAKIAEQLKSIEFDRLKRMGKSKQRQLDYCTMCDLNFHGH
SQ  ISTHRKSEGHLQLKKFLHPKCIECNKEFATRIDYDTHLLSAEHLKKAAENNTKVGERKRQ
SQ  TLPISTEEEETRDLRLPQKRKKKPVKKEGEAADGEAKKEGAGDGEGAEGDEAEGEEAKEG
SQ  EEAADETKEGDELNESQEEEEVALPVDPEDCILDFNDGDEIPSEVDTRLPKYNWQRAVGP
SQ  GLISKLECYECSVCSKFFDTEVTAEIHSRTATHHRNFLKFINEKSSDTKIAQKRAAAALE
SQ  ENERKKRKVEEAEAPAAEGAAEETTEGAEGELYDPSEATGDDEDVEMVDDNAEGEGEGEG
SQ  DEEAEAEVEEDGAGQDNGEEEMEAQEEEGQEGEQEPEPEPAPVQTPAPAEPAPPAKTPAK
SQ  TPTKAAAPAAVASPAAAATSADASPSPAKKATPARAAAGAKATPQRQRARGRYNRY
SC  translated from EMBL #X56689
XX
SF  3 regular and 1 atypical C2H2 type zinc fingers [1]
XX
FF  identified in a search for MAR-binding proteins in fruitfly
FF  [1]; concluded to bind only non-specifically to MARs
FF  [1]; binds to DNA [1]; suggested to bind to RNA in a
FF  sequence-specific manner [1]
XX
BS  SM0000031; GG$LYS-5MAR [1]
MM  southwestern blotting;
PR  446 bp Hind III-Hae II fragment [1]
SO  Kc; Drosophila
BS  SM0000037; DROME$H1H3 [1]
MM  southwestern blotting;
PR  657 bp Hinf I - EcoR I fragment [1]
SO  Kc; Drosophila
BS  SM0000122; DROME$hsp70-MAR1 [1]
MM  southwestern blotting;
PR  1023 bp Xba I - BamH I fragment [1]
SO  Kc; Drosophila
XX
DR  EMBL: X56689; DMPEP; r 
DR  SwissProt: P41073; PEP_DROME
XX
RN  [1]
RX  MEDLINE;  PubMed; 9722628
RA  Hamann, S., Straetling, W. H.
RT  Specific binding of Drosophila nuclear protein PEP (protein
RT  on ecdysone puffs) to hsp70 DNA and RNA
RL  Nucleic Acids Res. 26:4108-4115 (1998)
//